Loading...
Statistics
Advertisement

Cait Scott - Wet Nose Gardens
www.caitscott.com/

Caitscott.com

Advertisement
Caitscott.com is hosted in United States / Culver City . Caitscott.com uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Cufon, Html, Number of used javascripts: 12. First javascripts: Jquery.min.js, Jquery.fade.js, Jquery.livetwitter.js, Number of used analytics tools: 0. Number of used plugins, modules: 3. Its server type is: Apache/2.2.22. Its CMS is: Wordpress.

Technologies in use by Caitscott.com

Technology

Number of occurences: 7
  • CSS
  • Cufon
  • Html
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 12
  • jquery.min.js
  • jquery.fade.js
  • jquery.livetwitter.js
  • jquery.imagepreview.js
  • jquery.smoothscroll.js
  • cufon.js
  • Graublau_Web_400-Graublau_Web_700.font.js
  • shareaholic.js
  • jquery.js
  • jquery-migrate.min.js
  • jscripts-ftr-min.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache/2.2.22

Powered by

  • PHP/5.3.29

CDN

Number of occurences: 1
  • CloudFront

Used plugins, modules

Number of plugins and modules: 3
  • wp spamshield
  • nextgen gallery
  • ngglegacy

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Caitscott.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.gridserver.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.gridserver.com
    • hash: d8a988c8
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 11198607473376485
    • validFrom: 140411163449Z
    • validTo: 170411163449Z
    • validFrom_time_t: 1397234089
    • validTo_time_t: 1491928489
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-40.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:*.gridserver.com, DNS:gridserver.com
      • subjectKeyIdentifier: 06:65:8B:66:B6:62:E2:D2:7E:DD:30:B7:5A:00:F3:B2:75:BC:34:95

Meta - Caitscott.com

Number of occurences: 8
  • Name:
    Content: text/html; charset=UTF-8
  • Name: description
    Content:
  • Name: keywords
    Content: farming,gardening,homestead,homesteading,love,nature
  • Name: shareaholic:site_name
    Content: Cait Scott - Wet Nose Gardens
  • Name: shareaholic:language
    Content: en-US
  • Name: shareaholic:site_id
    Content: 8062fdb6d925bfa53bb6980707933fd4
  • Name: shareaholic:wp_version
    Content: 7.6.1.1
  • Name: generator
    Content: WordPress 4.5.1

Server / Hosting

  • IP: 64.13.232.86
  • Latitude: 34.02
  • Longitude: -118.39
  • Country: United States
  • City: Culver City

Rname

  • ns1.mediatemple.net
  • ns2.mediatemple.net
  • mail.caitscott.com

Target

  • dnsadmin.mediatemple.net

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 02 May 2016 02:57:48 GMT Server: Apache/2.2.22 X-Powered-By: PHP/5.3.29 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-UA-Compatible: IE=edge Link: ; rel="https://api.w.org/" Set-Cookie: PHPSESSID=e99d7281bee74ff5eee8830c9eea22e9; path=/ Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8

DNS

host: caitscott.com
  1. class: IN
  2. ttl: 43195
  3. type: A
  4. ip: 64.13.232.86
host: caitscott.com
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns1.mediatemple.net
host: caitscott.com
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns2.mediatemple.net
host: caitscott.com
  1. class: IN
  2. ttl: 43200
  3. type: SOA
  4. mname: ns1.mediatemple.net
  5. rname: dnsadmin.mediatemple.net
  6. serial: 2013080801
  7. refresh: 10800
  8. retry: 3600
  9. expire: 1209600
  10. minimum-ttl: 43200
host: caitscott.com
  1. class: IN
  2. ttl: 43200
  3. type: MX
  4. pri: 10
  5. target: mail.caitscott.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.aitscott.com, www.cdaitscott.com, www.daitscott.com, www.craitscott.com, www.raitscott.com, www.ctaitscott.com, www.taitscott.com, www.cvaitscott.com, www.vaitscott.com, www.cfaitscott.com, www.faitscott.com, www.cgaitscott.com, www.gaitscott.com, www.chaitscott.com, www.haitscott.com, www.cnaitscott.com, www.naitscott.com, www.cmaitscott.com, www.maitscott.com, www.cjaitscott.com, www.jaitscott.com, www.citscott.com, www.caoitscott.com, www.coitscott.com, www.capitscott.com, www.cpitscott.com, www.ca9itscott.com, www.c9itscott.com, www.caitscott.com, www.citscott.com, www.caiitscott.com, www.ciitscott.com, www.cauitscott.com, www.cuitscott.com, www.catscott.com, www.cairtscott.com, www.cartscott.com, www.caiftscott.com, www.caftscott.com, www.caivtscott.com, www.cavtscott.com, www.caiktscott.com, www.caktscott.com, www.cai,tscott.com, www.ca,tscott.com, www.caibtscott.com, www.cabtscott.com, www.caigtscott.com, www.cagtscott.com, www.caittscott.com, www.cattscott.com, www.caiytscott.com, www.caytscott.com, www.caiutscott.com, www.cautscott.com, www.caijtscott.com, www.cajtscott.com, www.caimtscott.com, www.camtscott.com, www.caintscott.com, www.cantscott.com, www.caiscott.com, www.caitqscott.com, www.caiqscott.com, www.caitascott.com, www.caiascott.com, www.cait scott.com, www.cai scott.com, www.caitwscott.com, www.caiwscott.com, www.caitescott.com, www.caiescott.com, www.caitzscott.com, www.caizscott.com, www.caitxscott.com, www.caixscott.com, www.caitcscott.com, www.caicscott.com, www.caitcott.com, www.caitsecott.com, www.caitecott.com, www.caitswcott.com, www.caitwcott.com, www.caitsdcott.com, www.caitdcott.com, www.caitsxcott.com, www.caitxcott.com, www.caitsfcott.com, www.caitfcott.com, www.caitsgcott.com, www.caitgcott.com, www.caitstcott.com, www.caittcott.com, www.caitsott.com, www.caitscdott.com, www.caitsdott.com, www.caitscrott.com, www.caitsrott.com, www.caitsctott.com, www.caitstott.com, www.caitscvott.com, www.caitsvott.com, www.caitscfott.com, www.caitsfott.com, www.caitscgott.com, www.caitsgott.com, www.caitschott.com, www.caitshott.com, www.caitscnott.com, www.caitsnott.com, www.caitscmott.com, www.caitsmott.com, www.caitscjott.com, www.caitsjott.com, www.caitsctt.com, www.caitscobtt.com, www.caitscbtt.com, www.caitscohtt.com, www.caitschtt.com, www.caitscogtt.com, www.caitscgtt.com, www.caitscojtt.com, www.caitscjtt.com, www.caitscomtt.com, www.caitscmtt.com, www.caitsco tt.com, www.caitsc tt.com, www.caitscovtt.com, www.caitscvtt.com, www.caitscot.com, www.caitscotqt.com, www.caitscoqt.com, www.caitscotat.com, www.caitscoat.com, www.caitscot t.com, www.caitsco t.com, www.caitscotwt.com, www.caitscowt.com, www.caitscotet.com, www.caitscoet.com, www.caitscotzt.com, www.caitscozt.com, www.caitscotxt.com, www.caitscoxt.com, www.caitscotct.com, www.caitscoct.com, www.caitscot.com, www.caitscottq.com, www.caitscotq.com, www.caitscotta.com, www.caitscota.com, www.caitscott .com, www.caitscot .com, www.caitscottw.com, www.caitscotw.com, www.caitscotte.com, www.caitscote.com, www.caitscottz.com, www.caitscotz.com, www.caitscottx.com, www.caitscotx.com, www.caitscottc.com, www.caitscotc.com,

Other websites we recently analyzed

  1. wartwood.ru
    Russian Federation - 31.31.204.59
    Server software: nginx
    Technology: CSS, Html, Html5
    Number of Javascript: 3
    Number of meta tags: 2
  2. putabirdonit
    Brea (United States) - 69.163.153.119
    Server software: Apache
    Technology: Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  3. pleasegivewillyapleasemaamsir.biz
    Scottsdale (United States) - 50.63.202.45
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. TXMayday Enterprises - Airplane enginees, parts
    The web-based aircraft parts locater system, marketplace and business network for the aviation industry. We bring buyers and sellers together - global, fast and effective
    Scottsdale (United States) - 50.63.196.46
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 5
  5. spherepr.net
    Australia - 202.124.241.178
    Server software: Redirector - NetRegistry Pty Ltd
    Technology: Html
    Number of meta tags: 2
  6. kmlsny.com
    San Jose (United States) - 69.46.84.52
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  7. hollyenerqy.com
    New York (United States) - 69.172.201.217
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  8. inculata.org
    Dallas (United States) - 75.126.102.254
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. Винтовые сваи - Установка и продажа винтовых свай дешево!
    Винтовые сваи в Челябинске и области по низким ценам! Бесплатный расчет фундамента - быстро, качественно, гарантии!
    Germany - 37.1.219.22
    Server software: nginx/1.0.15
    Technology: CSS, Html, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 7
    Number of meta tags: 2
  10. Test 33 | Home
    Test 33 | Home
    Italy - 109.168.121.67
    G Analytics ID: UA-36932869-3
    Server software: Apache
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery Validate, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 4

Check Other Websites